PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.132300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 241aa    MW: 28041.9 Da    PI: 7.1142
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.132300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.73.2e-141460248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     + W +eEd++l  +v+ +G g+W+ ++++ g+ R +k+c++rw +yl
   Cucsa.132300.1 14 NLWKPEEDLILRSYVETHGEGNWAIVSQESGLMRGAKSCRLRWKNYL 60
                     56*******************************************97 PP

2Myb_DNA-binding52.51.1e-1666111148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +++eE++l+++ +k+lG++ W++Ia +++ gRt++++k++w+++l
   Cucsa.132300.1  66 RGGMSKEEEDLIIRMHKLLGNR-WSLIAGRLP-GRTDNEVKNYWNTHL 111
                      67799*****************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.419860IPR017930Myb domain
SuperFamilySSF466891.84E-2712107IPR009057Homeodomain-like
SMARTSM007171.2E-111262IPR001005SANT/Myb domain
PfamPF002494.0E-131460IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-201567IPR009057Homeodomain-like
CDDcd001672.01E-91660No hitNo description
PROSITE profilePS5129423.92961115IPR017930Myb domain
SMARTSM007171.8E-1665113IPR001005SANT/Myb domain
PfamPF002495.0E-1566111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-2368113IPR009057Homeodomain-like
CDDcd001673.98E-1269111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010026Biological Processtrichome differentiation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MEESKAMKQQ PKKNLWKPEE DLILRSYVET HGEGNWAIVS QESGLMRGAK SCRLRWKNYL  60
RPNIKRGGMS KEEEDLIIRM HKLLGNRWSL IAGRLPGRTD NEVKNYWNTH LNKNGLQDKR  120
KANNSNSCKK NDDNNSDDGN NKKQKKVINQ IYYPQPPICS DNGTDLAHDI QRRNQEENRE  180
KQDPWNMDDI TSSHYNINSP MIPANNTTFN FDDEPYFDHL DPFFLFEAFG CSSVDASLDN  240
X
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-21131137106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818470.0LN681847.1 Cucumis melo genomic scaffold, anchoredscaffold00003.
GenBankLN7132590.0LN713259.1 Cucumis melo genomic chromosome, chr_5.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004139409.10.0PREDICTED: transcription factor WER-like
SwissprotQ9LTF72e-61MYB82_ARATH; Transcription factor MYB82
TrEMBLW9SZ252e-88W9SZ25_9R
STRINGPOPTR_0018s12780.18e-88(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF135452026
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52600.13e-62myb domain protein 82